VMWare Virtual Appliance Interface (VAMI) – Log-In Failed

The VMware Appliance has a web interface and SSH login capability. After vSphere version 5.5, the old-style Java-based client was phased out, replaced by the much more responsive HTML5 application.

VAMI Unable to Login

I encountered a bizarre problem today when I could not log in to my vCenter appliance. I know the password and the user account, but I was just getting this error:

Vmware Appliance Management console login error "unable to login"
unable to log in error

Now, I was 100% certain of the password. To confirm, I logged into the appliance via SSH with the exact same credentials. As you can see, SSH was working fine. How Weird!

credentials working fine via SSH

The cause of this error was that the applmgmt service was not running. Here is how to fix it:

Step 1 – Log into your vCenter appliance via SSH

Choose Your SSH Client: While PuTTY is popular, any SSH client (like OpenSSH on Linux/macOS or even the built-in Windows OpenSSH client) will work.

Gather Credentials:

  • Root Access:
    Ideally, use the root user account. This grants the highest privileges necessary for many administrative tasks.
  • Alternative:
    If root access is unavailable, use the [email protected] account (replace “vsphere.local” with your Single Sign-On domain if it’s different). This account may require additional permissions for certain operations.

Obtain the VCSA’s IP Address or Hostname: Ensure you have the correct network address for your vCenter appliance.

Initiate the Connection: Open your SSH client, enter the IP address or hostname, and connect. You’ll be prompted for your username and password.

Step 2 – Check What Services are running on the vCenter Appliance

From the command line, type the following to list the running services:

Bash
service-control--status

You will get output similar to this. You are looking for the applmgmt service. See the highlighted text below.

Bash
root@vcenter#service-control--statusRunning:lwsmdpschealthvmafddvmcadvmdirdvmdnsdvmonapivmware-analyticsvmware-certificatemanagementvmware-cis-licensevmware-cmvmware-content-libraryvmware-eamvmware-perfchartsvmware-podvmware-postgres-archivervmware-rhttpproxyvmware-scavmware-spsvmware-sts-idmdvmware-stsdvmware-topologysvcvmware-updatemgrvmware-vapi-endpointvmware-vmonvmware-vpostgresvmware-vpxdvmware-vpxd-svcsvmware-vsan-healthvmware-vsmvsphere-clientvsphere-uiStopped:applmgmtvmcamvmware-imagebuildervmware-mbcsvmware-netdumpervmware-rbd-watchdogvmware-statsmonitorvmware-vchavsan-dps

Step 3 – Start the applmgmt Service

To start the service, simply type:

Bash
service-control--startapplmgmt

Bash
root@vcenter[ /var/log/vmware/applmgmt]#service-control--startapplmgmtOperationnotcancellable.Pleasewaitforittofinish…Performingstartoperationonserviceapplmgmt…Successfullystartedserviceapplmgmt

Step 4 – Test Access to the VMware Virtual Appliance

Now log into the vCenter Appliance Management Interface

boom! it worked 🙂
Elsewhere On TurboGeek:  How to Remove a Directory in Linux (rmdir)

Richard.Bailey

Richard Bailey, a seasoned tech enthusiast, combines a passion for innovation with a knack for simplifying complex concepts. With over a decade in the industry, he's pioneered transformative solutions, blending creativity with technical prowess. An avid writer, Richard's articles resonate with readers, offering insightful perspectives that bridge the gap between technology and everyday life. His commitment to excellence and tireless pursuit of knowledge continues to inspire and shape the tech landscape.

You may also like...

2 Responses

  1. Michaelsays:

    Thanks a lot for this post. It worked in my case although I had some more services not running.

Leave a Reply

Your email address will not be published.Required fields are marked *

Translate »